Sequence 1: | NP_001097306.2 | Gene: | cg / 36571 | FlyBaseID: | FBgn0000289 | Length: | 837 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651878.1 | Gene: | CG1792 / 43727 | FlyBaseID: | FBgn0039860 | Length: | 372 | Species: | Drosophila melanogaster |
Alignment Length: | 323 | Identity: | 80/323 - (24%) |
---|---|---|---|
Similarity: | 127/323 - (39%) | Gaps: | 87/323 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 EECNEILIKRAIAAGHHQTHTITAADGSHHHASGG-----TPSFCS----------------VGG 222
Fly 223 ATTL-----LG--DILPGISVQVQKVIQG------------------LEDNED-----SQGEAPN 257
Fly 258 LKL--EPGTLELSPKT--ELQESMHFSE-TDAT--------------IKKE---RPYSCDECGKS 300
Fly 301 FLLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLT 365
Fly 366 HSRV-HSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFHG 427 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
cg | NP_001097306.2 | COG5048 | 287..>371 | CDD:227381 | 23/87 (26%) |
C2H2 Zn finger | 294..314 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 306..331 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 322..342 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 350..370 | CDD:275368 | 4/20 (20%) | ||
zf-H2C2_2 | 362..385 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 378..398 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 390..415 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 406..426 | CDD:275368 | 8/19 (42%) | ||
SIR2 | <425..>465 | CDD:294129 | 1/3 (33%) | ||
C2H2 Zn finger | 434..454 | CDD:275368 | |||
C2H2 Zn finger | 461..482 | CDD:275368 | |||
C2H2 Zn finger | 490..509 | CDD:275368 | |||
lambda-1 | 491..>603 | CDD:212564 | |||
C2H2 Zn finger | 575..595 | CDD:275368 | |||
C2H2 Zn finger | 720..740 | CDD:275368 | |||
C2H2 Zn finger | 752..771 | CDD:275368 | |||
CG1792 | NP_651878.1 | zf-AD | 6..80 | CDD:214871 | 13/69 (19%) |
C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 226..243 | CDD:275368 | 4/16 (25%) | ||
C2H2 Zn finger | 254..275 | CDD:275368 | 4/20 (20%) | ||
zf-C2H2 | 281..303 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 283..303 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 296..320 | CDD:290200 | 10/23 (43%) | ||
C2H2 Zn finger | 311..329 | CDD:275368 | 7/17 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24388 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |