DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and ouib

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:174 Identity:58/174 - (33%)
Similarity:85/174 - (48%) Gaps:18/174 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 TLELSPKTELQE---------SMHFSETDATIKKERPYSCDECGKSFLLKHHLTTHARVHTGERP 319
            ||....|.:|:|         |....:. :|...::.|.|:.||.....|.....|.|.|.||||
  Fly   131 TLNRDAKAQLREDGIDEKCVPSQKIIKV-STKLDDQIYICELCGTHATSKPTFQRHMRKHRGERP 194

  Fly   320 HICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGR- 383
            ..|..|...|.....|..|..:|:.|:|:.|:.|:|.:......|.|.|.|:.:||:||:|||: 
  Fly   195 FGCKDCDARFLSAGELRAHHRVHTGEQPFACRFCEKRYVSYMGRLIHERTHTNDRPYVCEECGKK 259

  Fly   384 ---AFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSR 424
               |:.||.|:|    .|.|||.:.|:.|..||.::.||:.|:|
  Fly   260 FTTAYVLKNHMV----IHTGERNFRCDICDRSFQRKAHLVTHTR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 26/83 (31%)
C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
zf-H2C2_2 306..331 CDD:290200 10/24 (42%)
C2H2 Zn finger 322..342 CDD:275368 5/19 (26%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
zf-H2C2_2 362..385 CDD:290200 11/26 (42%)
C2H2 Zn finger 378..398 CDD:275368 9/23 (39%)
zf-H2C2_2 390..415 CDD:290200 10/24 (42%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
SIR2 <425..>465 CDD:294129 58/174 (33%)
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871
COG5048 <158..300 CDD:227381 52/147 (35%)
C2H2 Zn finger 169..189 CDD:275368 6/19 (32%)
C2H2 Zn finger 197..217 CDD:275368 5/19 (26%)
zf-H2C2_2 209..234 CDD:290200 8/24 (33%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
zf-H2C2_2 241..262 CDD:290200 10/20 (50%)
C2H2 Zn finger 253..273 CDD:275368 9/23 (39%)
zf-H2C2_2 266..288 CDD:290200 10/25 (40%)
C2H2 Zn finger 281..299 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.