DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and nom

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:196 Identity:62/196 - (31%)
Similarity:89/196 - (45%) Gaps:20/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 GISVQVQKVIQGLEDNEDSQGEAPNLKLEPGTLELSPKTELQESMHFSETDATIKKERPYSCDEC 297
            |.||...:..|.:|.:.:......::.||  .::|..:..|       |:|..:...:.:.||.|
  Fly   132 GESVGGDEFDQPVEISNEPDATDSDVNLE--EIDLPDEDGL-------ESDHDLPNVQIHKCDTC 187

  Fly   298 G-----KSFLLKHHLTTHARVHTGERPHICTHCGKSFAHKHCLNTHLLLHST-ERPYQCQECKKS 356
            |     ||.|::|...     |.|.||:.|..|.|:|.....|..|.|.|.| |.|:.|:.|.:.
  Fly   188 GIIKNNKSSLVRHQFE-----HNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRR 247

  Fly   357 FTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIM 421
            :........|.|||:.||||||.:||:||.....|..|...|...|.|.|:.|..||:.:.||..
  Fly   248 YFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLAT 312

  Fly   422 H 422
            |
  Fly   313 H 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 28/89 (31%)
C2H2 Zn finger 294..314 CDD:275368 8/24 (33%)
zf-H2C2_2 306..331 CDD:290200 8/24 (33%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 4/19 (21%)
zf-H2C2_2 362..385 CDD:290200 12/22 (55%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 9/24 (38%)
C2H2 Zn finger 406..426 CDD:275368 7/17 (41%)
SIR2 <425..>465 CDD:294129
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 8/24 (33%)
C2H2 Zn finger 212..261 CDD:275368 15/48 (31%)
zf-H2C2_2 255..278 CDD:290200 14/22 (64%)
C2H2 Zn finger 269..289 CDD:275368 7/19 (37%)
zf-H2C2_2 282..305 CDD:290200 8/22 (36%)
C2H2 Zn finger 297..313 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.