DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and Kah

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_612040.1 Gene:Kah / 38072 FlyBaseID:FBgn0035144 Length:442 Species:Drosophila melanogaster


Alignment Length:469 Identity:97/469 - (20%)
Similarity:151/469 - (32%) Gaps:127/469 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LSLDKNYLLVDPATAAAAAAAAGGDSGLAHHHTLTNGSIVDAKTGQTVLTAGSAAAKSHFSSIGA 173
            ::|....|:.|........|::..||....|.....     .|..:..::..::.|.|..||..:
  Fly    23 VTLSVGPLVTDEVKPLPLYASSDDDSNYYSHKVFDR-----RKLRRCTISDSNSCASSSSSSTSS 82

  Fly   174 LHLTQEECNEILIKRAIAAGHHQTHTITAADGSHHHASGGTPSFCSVGGATTLLGDILPGISVQV 238
            ...:::...        ..||...|        |||.                            
  Fly    83 RQSSEDHLG--------LQGHSSVH--------HHHG---------------------------- 103

  Fly   239 QKVIQGLEDNEDSQGEAPNLKLEPGTLELSPKTELQESMHFSETDATIKKERPYSCDECGKSFLL 303
                        .|||..|            .|.|.|..|.              |.||||.:..
  Fly   104 ------------EQGEILN------------STSLLEDEHI--------------CPECGKKYST 130

  Fly   304 KHHLTTHARVHTG---ERPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLT 365
            ..:|..|.:.|..   ::...|.:|.|.:......:.|:..|:  :..:||.|.|.|:....|..
  Fly   131 SSNLARHRQTHRSIMDKKARHCPYCEKVYVSMPAYSMHVRTHN--QGCECQFCGKRFSRPWLLQG 193

  Fly   366 HSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLN 430
            |.|.|:.|:||.|..|.:||..|.:|..|.:.|:..:|:.|..||::||.:::|..|.......|
  Fly   194 HIRTHTGEKPFKCGVCEKAFADKSNLRAHIQTHSNTKPHTCARCGKAFALKSYLYKHEESSCMKN 258

  Fly   431 PFVCAECGA-------SFPRKFQL-VNHGRIHGKIPHS--CTVCGKEFLQKRTLVSHMRRVHTGE 485
            .......||       |.|::.|. |..|.|....|.|  ..||......|.||.:.:  :...:
  Fly   259 RGGVPGSGAASGNRPPSSPKRQQAEVTSGTISALAPGSPAAAVCAASDSAKSTLANKL--LQKEK 321

  Fly   486 QAHPCVSCGEGFLTKAEL--HQHVRTAH---------NGVNPNTSSATIIANQQ--LQQAH---- 533
            .........:||....|:  :.|..:|.         |.:.|......:.:..|  |...|    
  Fly   322 DRRQAAMAFQGFPAGPEVTAYSHATSAQEEYEKFKRINVIQPKVMPHRVPSLYQDLLPNRHVPLA 386

  Fly   534 ------HHQAGQQT 541
                  :|..||.|
  Fly   387 LPLAMPYHFQGQAT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 21/86 (24%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
zf-H2C2_2 306..331 CDD:290200 6/27 (22%)
C2H2 Zn finger 322..342 CDD:275368 4/19 (21%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
zf-H2C2_2 362..385 CDD:290200 9/22 (41%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
zf-H2C2_2 390..415 CDD:290200 8/24 (33%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
SIR2 <425..>465 CDD:294129 12/49 (24%)
C2H2 Zn finger 434..454 CDD:275368 7/27 (26%)
C2H2 Zn finger 461..482 CDD:275368 5/20 (25%)
C2H2 Zn finger 490..509 CDD:275368 4/20 (20%)
lambda-1 491..>603 CDD:212564 14/74 (19%)
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
KahNP_612040.1 zf-C2H2 119..141 CDD:278523 8/35 (23%)
C2H2 Zn finger 121..141 CDD:275368 7/19 (37%)
zf-C2H2 176..198 CDD:278523 8/21 (38%)
C2H2 Zn finger 178..198 CDD:275368 8/19 (42%)
zf-H2C2_2 191..214 CDD:290200 10/22 (45%)
zf-C2H2 204..226 CDD:278523 8/21 (38%)
C2H2 Zn finger 206..226 CDD:275368 7/19 (37%)
zf-H2C2_2 218..242 CDD:290200 7/23 (30%)
C2H2 Zn finger 234..250 CDD:275368 6/15 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.