DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and fezf-1

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_502594.2 Gene:fezf-1 / 3564888 WormBaseID:WBGene00012639 Length:218 Species:Caenorhabditis elegans


Alignment Length:200 Identity:68/200 - (34%)
Similarity:93/200 - (46%) Gaps:17/200 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 SPKTELQESMHF---------------SETDATIKKERPYSCDECGKSFLLKHHLTTHARVHTGE 317
            |||:..:.|..|               |..|...:|:.|  |:.|||.|...::||.|..|||||
 Worm    15 SPKSLCRSSGIFPFPLPSSNSIFAESSSGDDENSRKKFP--CEICGKQFNAHYNLTRHMPVHTGE 77

  Fly   318 RPHICTHCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECG 382
            ||.:|..|||:|.....|..|.::|:..:|::|:.|.|.|.....|.||.|:|...:||||:.||
 Worm    78 RPFVCKVCGKAFRQASTLCRHKIIHTDSKPHKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICG 142

  Fly   383 RAFPLKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLNPFVCAECGASFPRKFQL 447
            :.|....:...|...|...:.:.|..|..:|.|..:|..|...|....||.|..|...|.|.|.|
 Worm   143 KGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTHEEHKPFTCHVCSKGFCRNFDL 207

  Fly   448 VNHGR 452
            ..|.|
 Worm   208 KKHLR 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 34/83 (41%)
C2H2 Zn finger 294..314 CDD:275368 8/19 (42%)
zf-H2C2_2 306..331 CDD:290200 15/24 (63%)
C2H2 Zn finger 322..342 CDD:275368 7/19 (37%)
C2H2 Zn finger 350..370 CDD:275368 8/19 (42%)
zf-H2C2_2 362..385 CDD:290200 11/22 (50%)
C2H2 Zn finger 378..398 CDD:275368 5/19 (26%)
zf-H2C2_2 390..415 CDD:290200 5/24 (21%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
SIR2 <425..>465 CDD:294129 10/27 (37%)
C2H2 Zn finger 434..454 CDD:275368 7/18 (39%)
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
fezf-1NP_502594.2 COG5048 <13..212 CDD:227381 67/198 (34%)
DUF3449 <50..>70 CDD:288759 9/21 (43%)
C2H2 Zn finger 54..74 CDD:275368 8/19 (42%)
zf-H2C2_2 66..91 CDD:290200 15/24 (63%)
C2H2 Zn finger 82..102 CDD:275368 7/19 (37%)
C2H2 Zn finger 110..130 CDD:275368 8/19 (42%)
C2H2 Zn finger 138..158 CDD:275368 5/19 (26%)
C2H2 Zn finger 166..186 CDD:275368 6/19 (32%)
C2H2 Zn finger 194..212 CDD:275368 7/17 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.