DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment cg and sna

DIOPT Version :9

Sequence 1:	NP_001097306.2	Gene:	cg / 36571	FlyBaseID:	FBgn0000289	Length:	837	Species:	Drosophila melanogaster
Sequence 2:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster

Alignment Length:	143	Identity:	44/143 - (30%)
Similarity:	69/143 - (48%)	Gaps:	9/143 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   288 KERPYSCDECGKSFLLKHHLTTHARVH-------TGERPHICTHCGKSFAHKHCLNTHLLLHSTE 345
            |...:.||||.|.:.....|:.|.:.|       ..::.|.|..|||.:.....|..|:..|:.
  Fly   241 KNYRFKCDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIRTHTL- 304

  Fly   346 RPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTHSKFHAGERPYVCEECG 410
             |.:|..|.|:|:....|..|.|.|:.|:||.|.:|.|:|..:.:|..|.:.|...:.|.|:.|.
  Fly   305 -PCKCPICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCH 368

  Fly   411 ESFAQENHLIMHS 423
            :||::.:.|..||
  Fly   369 KSFSRMSLLNKHS 381

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
cg	NP_001097306.2	COG5048	287..>371	CDD:227381	25/89 (28%)
		C2H2 Zn finger	294..314	CDD:275368	7/19 (37%)
		zf-H2C2_2	306..331	CDD:290200	8/31 (26%)
		C2H2 Zn finger	322..342	CDD:275368	6/19 (32%)
		C2H2 Zn finger	350..370	CDD:275368	7/19 (37%)
		zf-H2C2_2	362..385	CDD:290200	10/22 (45%)
		C2H2 Zn finger	378..398	CDD:275368	6/19 (32%)
		zf-H2C2_2	390..415	CDD:290200	8/24 (33%)
		C2H2 Zn finger	406..426	CDD:275368	7/18 (39%)
		SIR2	<425..>465	CDD:294129
		C2H2 Zn finger	434..454	CDD:275368
		C2H2 Zn finger	461..482	CDD:275368
		C2H2 Zn finger	490..509	CDD:275368
		lambda-1	491..>603	CDD:212564
		C2H2 Zn finger	575..595	CDD:275368
		C2H2 Zn finger	720..740	CDD:275368
		C2H2 Zn finger	752..771	CDD:275368
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	7/19 (37%)
		zf-H2C2_2	321..344	CDD:290200	10/22 (45%)
		zf-C2H2	334..356	CDD:278523	7/21 (33%)
		C2H2 Zn finger	336..356	CDD:275368	6/19 (32%)
		zf-H2C2_2	348..373	CDD:290200	8/24 (33%)
		C2H2 Zn finger	364..380	CDD:275368	5/15 (33%)
		C2H2 Zn finger	247..267	CDD:275368	7/19 (37%)
		C2H2 Zn finger	282..302	CDD:275368	6/19 (32%)
		zf-C2H2	306..328	CDD:278523	7/21 (33%)
		COG5048	307..>356	CDD:227381	17/48 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24388
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100