DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and scrt2

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_998802.1 Gene:scrt2 / 325372 ZFINID:ZDB-GENE-030131-4097 Length:312 Species:Danio rerio


Alignment Length:177 Identity:53/177 - (29%)
Similarity:86/177 - (48%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 KTELQESMHFSETDATIKKE--------RPYSCDECGKSFLLKHHLTTHARVH---TGERPHICT 323
            |.|:.|:....|    ::||        ..::|:||||::....:|:.|.:.|   ..:....|.
Zfish   136 KGEVSEAAKADE----VEKEVVGVNNGGARHTCNECGKTYATSSNLSRHKQTHRSLDSKMARKCP 196

  Fly   324 HCGKSFAHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGRAFP-- 386
            .|.|.:.....|..|:|.|..:  ::|..|.|:|:....|..|.|.|:.|:||.|..||:||.  
Zfish   197 TCDKVYVSMPALAMHILTHDLK--HKCHVCSKAFSRPWLLQGHMRSHTGEKPFACAHCGKAFADR 259

  Fly   387 --LKRHLVTHSKFHAGERPYVCEECGESFAQENHLIMH---SRFHGS 428
              |:.|:.|||.|    :.|.|:.|.::||.:::|..|   :.|.||
Zfish   260 SNLRAHMQTHSAF----KHYSCKRCNKTFALKSYLNKHYESACFRGS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 24/94 (26%)
C2H2 Zn finger 294..314 CDD:275368 7/19 (37%)
zf-H2C2_2 306..331 CDD:290200 6/27 (22%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 7/19 (37%)
zf-H2C2_2 362..385 CDD:290200 10/22 (45%)
C2H2 Zn finger 378..398 CDD:275368 10/23 (43%)
zf-H2C2_2 390..415 CDD:290200 9/24 (38%)
C2H2 Zn finger 406..426 CDD:275368 6/22 (27%)
SIR2 <425..>465 CDD:294129 3/4 (75%)
C2H2 Zn finger 434..454 CDD:275368
C2H2 Zn finger 461..482 CDD:275368
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
scrt2NP_998802.1 zf-C2H2 162..184 CDD:278523 7/21 (33%)
C2H2 Zn finger 164..184 CDD:275368 7/19 (37%)
C2H2 Zn finger 195..212 CDD:275371 4/16 (25%)
COG5048 219..>295 CDD:227381 29/79 (37%)
zf-C2H2 219..241 CDD:278523 7/21 (33%)
C2H2 Zn finger 221..241 CDD:275368 7/19 (37%)
zf-H2C2_2 234..257 CDD:290200 11/22 (50%)
zf-C2H2 247..269 CDD:278523 8/21 (38%)
C2H2 Zn finger 249..269 CDD:275368 7/19 (37%)
C2H2 Zn finger 277..293 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.