DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cg and GLI4

DIOPT Version :9

Sequence 1:NP_001097306.2 Gene:cg / 36571 FlyBaseID:FBgn0000289 Length:837 Species:Drosophila melanogaster
Sequence 2:NP_612474.1 Gene:GLI4 / 2738 HGNCID:4320 Length:376 Species:Homo sapiens


Alignment Length:222 Identity:82/222 - (36%)
Similarity:125/222 - (56%) Gaps:3/222 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 ELSPKTELQESMHFSET-DATIKKERPYSCDECGKSFLLKHHLTTHARVHTGERPHICTHCGKSF 329
            |.:|:...:..::|..: ..:.:..:|:.|:.|||||.....|..|.|:||||:|:.|..|||.|
Human   156 EGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRF 220

  Fly   330 AHKHCLNTHLLLHSTERPYQCQECKKSFTLKHHLLTHSRVHSRERPFVCQECGRAFPLKRHLVTH 394
            ........|..:|:.|:||:|.:|.::|:...|...|.|:|:.|:|:.|.|||:||....:||.|
Human   221 RGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRH 285

  Fly   395 SKFHAGERPYVCEECGESFAQENHLIMHSRFHGSLNPFVCAECGASFPRKFQLVNHGRIH-GKIP 458
            .:.|.||:||.|.:||::|...:.||.|.|.|....|:.|::||.:|..:.....|.|.| |:.|
Human   286 QRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKP 350

  Fly   459 HSCTVCGKEFLQKRTLVSHMRRVHTGE 485
            .:|..|||.|.|...|:.| :|||..|
Human   351 FACGACGKAFGQSSQLIQH-QRVHYRE 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cgNP_001097306.2 COG5048 287..>371 CDD:227381 31/83 (37%)
C2H2 Zn finger 294..314 CDD:275368 9/19 (47%)
zf-H2C2_2 306..331 CDD:290200 13/24 (54%)
C2H2 Zn finger 322..342 CDD:275368 6/19 (32%)
C2H2 Zn finger 350..370 CDD:275368 6/19 (32%)
zf-H2C2_2 362..385 CDD:290200 10/22 (45%)
C2H2 Zn finger 378..398 CDD:275368 9/19 (47%)
zf-H2C2_2 390..415 CDD:290200 12/24 (50%)
C2H2 Zn finger 406..426 CDD:275368 8/19 (42%)
SIR2 <425..>465 CDD:294129 12/40 (30%)
C2H2 Zn finger 434..454 CDD:275368 6/19 (32%)
C2H2 Zn finger 461..482 CDD:275368 9/20 (45%)
C2H2 Zn finger 490..509 CDD:275368
lambda-1 491..>603 CDD:212564
C2H2 Zn finger 575..595 CDD:275368
C2H2 Zn finger 720..740 CDD:275368
C2H2 Zn finger 752..771 CDD:275368
GLI4NP_612474.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..97
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..135
COG5048 <181..343 CDD:227381 63/161 (39%)
zf-C2H2 183..205 CDD:278523 9/21 (43%)
C2H2 Zn finger 185..205 CDD:275368 9/19 (47%)
zf-H2C2_2 198..220 CDD:290200 12/21 (57%)
C2H2 Zn finger 213..233 CDD:275368 6/19 (32%)
zf-H2C2_2 228..250 CDD:290200 8/21 (38%)
C2H2 Zn finger 241..261 CDD:275368 6/19 (32%)
zf-H2C2_2 253..278 CDD:290200 12/24 (50%)
C2H2 Zn finger 269..289 CDD:275368 9/19 (47%)
zf-H2C2_2 281..304 CDD:290200 11/22 (50%)
C2H2 Zn finger 297..317 CDD:275368 8/19 (42%)
zf-H2C2_2 310..332 CDD:290200 9/21 (43%)
COG5048 321..>373 CDD:227381 19/52 (37%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
zf-H2C2_2 337..360 CDD:290200 9/22 (41%)
C2H2 Zn finger 353..373 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.