DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and rpsP

DIOPT Version :10

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_417100.1 Gene:rpsP / 947103 ECOCYCID:EG10915 Length:82 Species:Escherichia coli


Alignment Length:73 Identity:28/73 - (38%)
Similarity:44/73 - (60%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||..|.|...||||.:||.:.|..::...||:||.|:|:.:: .|....|:.:||.:|:|:||.:
E. coli     4 IRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASE-KEEGTRLDLDRIAHWVGQGATI 67

  Fly    85 STPAAELL 92
            |...|.|:
E. coli    68 SDRVAALI 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 24..85 CDD:459981 23/60 (38%)
rpsPNP_417100.1 RpsP 1..76 CDD:439998 28/73 (38%)

Return to query results.
Submit another query.