DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and MRPS16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_015312.1 Gene:MRPS16 / 856094 SGDID:S000005934 Length:121 Species:Saccharomyces cerevisiae


Alignment Length:115 Identity:37/115 - (32%)
Similarity:52/115 - (45%) Gaps:24/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERL----------VALNTERI 74
            ||..|.|..|.|.|:|||...||.:....||.:|::.|:|:...:|.          |.|:.:|.
Yeast     8 IRLARFGRKNSPVYNIVVANSRKARDAKPIEVLGTYVPVPSPVTKRELKRGVVPIKDVKLDFDRT 72

  Fly    75 RYWLGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWR-------NRRTAAE 117
            :||:|.||..|....:||..||:|       ..||.       ||:...|
Yeast    73 KYWIGVGAQPSETVTKLLRKAGIL-------NDAWATSKNSNVNRKVVFE 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 31/87 (36%)
MRPS16NP_015312.1 S16 6..96 CDD:272848 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 43 1.000 Domainoid score I3189
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I1813
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58134
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - oto99603
orthoMCL 1 0.900 - - OOG6_101089
Panther 1 1.100 - - O PTHR12919
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1261
SonicParanoid 1 1.000 - - X2610
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.