DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and SSR16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_195188.1 Gene:SSR16 / 829614 AraportID:AT4G34620 Length:113 Species:Arabidopsis thaliana


Alignment Length:107 Identity:37/107 - (34%)
Similarity:56/107 - (52%) Gaps:1/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||..||||.:||||.:||.:.:..:....||.:|.:|||....:...|:|..:||:|||..||..
plant     5 IRLARLGCKHRPFYRVVVADEKSRRDGKQIEVLGFYDPLQGKEDADRVSLKFDRIKYWLSVGAQP 69

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAAEAEASPEKAE 126
            :.....:|..|||:|..|...:.: :|.:.:.....||...|
plant    70 TDTVESMLFRAGLIPPKPMVVVGS-KNGQKSTSQHVSPITGE 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 30/77 (39%)
SSR16NP_195188.1 S16 3..83 CDD:272848 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I4049
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I2475
OMA 1 1.010 - - QHG58134
OrthoDB 1 1.010 - - D1630052at2759
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - otm3236
orthoMCL 1 0.900 - - OOG6_101089
Panther 1 1.100 - - O PTHR12919
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2610
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.