DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and Mrps16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001102988.1 Gene:Mrps16 / 688912 RGDID:1582995 Length:135 Species:Rattus norvegicus


Alignment Length:117 Identity:52/117 - (44%)
Similarity:73/117 - (62%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||....||||||||.||....:..:....:||:||:|||||.:.|:|||||.:|||:|:|.||.|
  Rat    19 IRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAQL 83

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAA--------EAEASPEKAEST 128
            |.|..:|||::|..|:||.....|.|.||..|        :|::.|::.|::
  Rat    84 SKPMEKLLGLSGFFPLHPMMITNAERLRRKRAREVFLASQKADSEPQETEAS 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 41/77 (53%)
Mrps16NP_001102988.1 S16 17..97 CDD:272848 41/77 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345939
Domainoid 1 1.000 77 1.000 Domainoid score I8684
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9370
Inparanoid 1 1.050 105 1.000 Inparanoid score I4846
OMA 1 1.010 - - QHG58134
OrthoDB 1 1.010 - - D1630052at2759
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - oto97054
orthoMCL 1 0.900 - - OOG6_101089
Panther 1 1.100 - - LDO PTHR12919
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2610
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.