DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and mrps16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001016347.1 Gene:mrps16 / 549101 XenbaseID:XB-GENE-5805277 Length:141 Species:Xenopus tropicalis


Alignment Length:119 Identity:54/119 - (45%)
Similarity:75/119 - (63%) Gaps:5/119 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YAKSAKIIRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYW 77
            |.|....||....||||||||.||....::.:....:||:|::||:||.|||:||:||.|:|:||
 Frog    12 YHKGHVAIRLALAGCTNRPFYRIVAAHNKRARDGKYLEQLGTYDPMPNIYNEKLVSLNIEQIKYW 76

  Fly    78 LGKGAHLSTPAAELLGIAGLLPIHPRTYMTAWRNRR-----TAAEAEASPEKAE 126
            :|.|||.:.|.|:|||:||..|:||.|...|.|.:|     :.|||..:.:..|
 Frog    77 IGCGAHTTKPVAKLLGLAGFFPLHPMTITNAERLKREKEKQSNAEAPLTLDSKE 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 41/77 (53%)
mrps16NP_001016347.1 S16 17..97 CDD:272848 41/79 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 80 1.000 Domainoid score I8507
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9370
Inparanoid 1 1.050 113 1.000 Inparanoid score I4710
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1630052at2759
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - oto103748
Panther 1 1.100 - - LDO PTHR12919
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2610
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.