DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and MRPS16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_057149.1 Gene:MRPS16 / 51021 HGNCID:14048 Length:137 Species:Homo sapiens


Alignment Length:119 Identity:56/119 - (47%)
Similarity:72/119 - (60%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLPNDYNERLVALNTERIRYWLGKGAHL 84
            ||....||||||||.||....:..:....:||:||:|||||.:.|:|||||.:|||:|:|.||||
Human    19 IRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHL 83

  Fly    85 STPAAELLGIAGLLPIHPRTYMTAWRNRRTAA----------EAEASPEKAEST 128
            |.|..:|||:||..|:||.....|.|.||..|          :|||:..:|..|
Human    84 SKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 43/77 (56%)
MRPS16NP_057149.1 S16 17..97 CDD:272848 43/77 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152424
Domainoid 1 1.000 81 1.000 Domainoid score I8561
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9370
Inparanoid 1 1.050 108 1.000 Inparanoid score I4923
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58134
OrthoDB 1 1.010 - - D1630052at2759
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - oto89938
orthoMCL 1 0.900 - - OOG6_101089
Panther 1 1.100 - - LDO PTHR12919
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2610
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.