DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS16 and mrps16

DIOPT Version :9

Sequence 1:NP_523737.1 Gene:mRpS16 / 36570 FlyBaseID:FBgn0033907 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_595230.2 Gene:mrps16 / 2541005 PomBaseID:SPBC354.06 Length:96 Species:Schizosaccharomyces pombe


Alignment Length:90 Identity:37/90 - (41%)
Similarity:44/90 - (48%) Gaps:7/90 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IRFVRLGCTNRPFYHIVVMERRKNQHQPVIEQVGSFDPLP-----NDYNERL--VALNTERIRYW 77
            ||..|.|..|||||||||....|......||.:|:|||:|     .|...|:  :.||.||.:||
pombe     5 IRLARHGVRNRPFYHIVVANAWKAPQAKPIETIGTFDPIPKKIDSQDSIPRIKDIQLNVERFKYW 69

  Fly    78 LGKGAHLSTPAAELLGIAGLLPIHP 102
            :..||..|.....|.....|||..|
pombe    70 ISVGAQPSDTVRSLAEKFQLLPKKP 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS16NP_523737.1 Ribosomal_S16 20..98 CDD:294262 33/84 (39%)
mrps16NP_595230.2 RpsP 3..86 CDD:223306 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I3246
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I1989
OMA 1 1.010 - - QHG58134
OrthoFinder 1 1.000 - - FOG0003204
OrthoInspector 1 1.000 - - oto101232
orthoMCL 1 0.900 - - OOG6_101089
Panther 1 1.100 - - O PTHR12919
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1261
SonicParanoid 1 1.000 - - X2610
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.