DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22G

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001321035.1 Gene:HVA22G / 843904 AraportID:AT1G75700 Length:206 Species:Arabidopsis thaliana


Alignment Length:128 Identity:34/128 - (26%)
Similarity:46/128 - (35%) Gaps:32/128 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LCNIIGVLYPAYISIHAIESSTK--QDDTKWLIYW---------VTF------------------ 101
            |..:.|..||||.....:|.:..  |....|..||         :||                  
plant    10 LLMVFGYAYPAYECFKTVELNKPEIQQLQFWCQYWYMHTFYPLSITFLGSYINLASFHSKHLCRI 74

  Fly   102 --GIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDR 162
              ...|:.|.....|.|.:|.|...|.||.|:...| :..|:|.:|:...|||..||...:||
plant    75 IVAALTIFERIGDALVSWLPMYSEAKLAFFIYLWFP-KTKGTTYVYDSFFRPYIAKHENEIDR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 27/115 (23%)
HVA22GNP_001321035.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.