DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22A

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001323240.1 Gene:HVA22A / 843793 AraportID:AT1G74520 Length:177 Species:Arabidopsis thaliana


Alignment Length:86 Identity:28/86 - (32%)
Similarity:49/86 - (56%) Gaps:1/86 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCM 133
            ::.::||.|.|:.|||:.:..||.:||.|||.:.:.|:||...:.|...:|.:..:|.....|.:
plant    23 VVSLVYPLYASVQAIETQSHADDKQWLTYWVLYSLLTLIELTFAKLIEWLPIWSYMKLILTCWLV 87

  Fly   134 LPTEQNGSTIIYNKLVRPYFL 154
            :| ..:|:..:|...|||.|:
plant    88 IP-YFSGAAYVYEHFVRPVFV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 25/81 (31%)
HVA22ANP_001323240.1 TB2_DP1_HVA22 29..104 CDD:397309 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.