DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22C

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_177128.1 Gene:HVA22C / 843306 AraportID:AT1G69700 Length:184 Species:Arabidopsis thaliana


Alignment Length:95 Identity:27/95 - (28%)
Similarity:51/95 - (53%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCM 133
            ::.::||.|.|:.|||:.:..:|.:||.|||.:.:.::.|...|......|.:..:|...:.|.:
plant    25 LVTLVYPLYASVKAIETRSLPEDEQWLTYWVLYALISLFELTFSKPLEWFPIWPYMKLFGICWLV 89

  Fly   134 LPTEQNGSTIIYNKLVRPYFLKHHESVDRI 163
            || :.||:..||...:||::.....:..:|
plant    90 LP-QFNGAEHIYKHFIRPFYRDPQRATTKI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 24/81 (30%)
HVA22CNP_177128.1 TB2_DP1_HVA22 31..107 CDD:367349 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.