DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22H

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_564100.1 Gene:HVA22H / 838584 AraportID:AT1G19950 Length:315 Species:Arabidopsis thaliana


Alignment Length:108 Identity:34/108 - (31%)
Similarity:49/108 - (45%) Gaps:3/108 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LCNIIGVLYPAYISIHAIESS--TKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAF 128
            |..:.|..||||....|:|.:  ..|....|..||:.....|:.|.....|.|.:|.|...|.||
plant    10 LVMVFGYAYPAYECYKAVEKNKPEMQQLRFWCQYWILVAALTIFERVGDALASWVPLYCEAKLAF 74

  Fly   129 LIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKA 171
            .|:...| :..|:|.:|:...:||..||...:||.:.:...||
plant    75 FIYLWFP-KTRGTTYVYDSFFQPYVAKHENEIDRSLIELRTKA 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 26/86 (30%)
HVA22HNP_564100.1 TB2_DP1_HVA22 7..96 CDD:281172 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.