DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and AT5G42560

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_568606.1 Gene:AT5G42560 / 834262 AraportID:AT5G42560 Length:296 Species:Arabidopsis thaliana


Alignment Length:98 Identity:29/98 - (29%)
Similarity:43/98 - (43%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LCNIIGVLYPAYISIHAIESSTKQDDTK--WLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAF 128
            |..::|..||||.....:|.:..:.:..  |..||:.....||.|.......|.:|.|...|.||
plant    10 LVMVLGYAYPAYECYKTVEKNRPEIEQLRFWCQYWILVACLTVFERVGDAFVSWVPMYSEAKLAF 74

  Fly   129 LIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVD 161
            .|:...| :..|:|.:|....|||..:|...:|
plant    75 FIYLWYP-KTRGTTYVYESFFRPYLSQHENDID 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 24/86 (28%)
AT5G42560NP_568606.1 TB2_DP1_HVA22 19..97 CDD:397309 22/78 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.