DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22K

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_195390.2 Gene:HVA22K / 829825 AraportID:AT4G36720 Length:200 Species:Arabidopsis thaliana


Alignment Length:120 Identity:46/120 - (38%)
Similarity:69/120 - (57%) Gaps:3/120 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GAVGLCAIY--LIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFF 110
            |.|||..::  |......:..|..||:..|.|.:..||||..:.:..|.||||..:|.|:::|.|
plant    20 GEVGLRVLFSPLSSNIVLRTACCSIGIGLPVYSTFKAIESGDENEQQKMLIYWAAYGSFSLVEVF 84

  Fly   111 SSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIID 165
            :..:.|..|.|:.:|.|||:|..|||.: ||..|||..:||:.|:|...||:::|
plant    85 TDKIISWFPLYYHVKFAFLVWLQLPTVE-GSKQIYNNQIRPFLLRHQARVDQLVD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 34/87 (39%)
HVA22KNP_195390.2 TB2_DP1_HVA22 49..125 CDD:397309 32/76 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm3308
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.