DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and HVA22D

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001190830.1 Gene:HVA22D / 828598 AraportID:AT4G24960 Length:135 Species:Arabidopsis thaliana


Alignment Length:85 Identity:35/85 - (41%)
Similarity:52/85 - (61%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPT 136
            :|||.|.|:.|:||:||.||.:||.||:.:...::.|.....|...||.::.:|..|:.|.:||.
plant     2 LLYPLYASVIAMESTTKVDDEQWLAYWIIYSFLSLTELILQSLIEWIPIWYTVKLVFVAWLVLPQ 66

  Fly   137 EQNGSTIIYNKLVRPYFLKH 156
            .| |:..|||::||..|.||
plant    67 FQ-GAAFIYNRVVREQFKKH 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 31/78 (40%)
HVA22DNP_001190830.1 TB2_DP1_HVA22 2..79 CDD:281172 30/77 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I2421
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.