powered by:
Protein Alignment ReepB and AT2G46460
DIOPT Version :9
Sequence 1: | NP_001188928.1 |
Gene: | ReepB / 36569 |
FlyBaseID: | FBgn0033906 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_182169.1 |
Gene: | AT2G46460 / 819255 |
AraportID: | AT2G46460 |
Length: | 160 |
Species: | Arabidopsis thaliana |
Alignment Length: | 30 |
Identity: | 9/30 - (30%) |
Similarity: | 15/30 - (50%) |
Gaps: | 3/30 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QVKQFLNGYKD--DVSKSLRDASKPWTKVF 31
:|.:.||..|. |:...:||. :.|.:.|
plant 83 EVMEILNRRKSRFDIFNWIRDV-QAWKQRF 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ReepB | NP_001188928.1 |
TB2_DP1_HVA22 |
63..151 |
CDD:281172 |
|
AT2G46460 | NP_182169.1 |
RNase_H_like |
13..132 |
CDD:259998 |
9/30 (30%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1473891at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.