DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep4

DIOPT Version :10

Sequence 1:NP_610936.2 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006519661.1 Gene:Reep4 / 72549 MGIID:1919799 Length:293 Species:Mus musculus


Alignment Length:140 Identity:37/140 - (26%)
Similarity:63/140 - (45%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLCNII----GVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSS------------- 112
            ::|.::    |:|||||.|..|::|...::..:|::||:.|.||...|.|:.             
Mouse     5 MICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWSGPRIGRP 69

  Fly   113 -----------------------LLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFL 154
                                   |||...|||:..|.||::|.:.|..: |::::|.|.|.|...
Mouse    70 WGWEGPHHHHHHHLASGSHKPLPLLTHRFPFYYEFKMAFVLWLLSPYTK-GASLLYRKFVHPSLS 133

  Fly   155 KHHESVDRII 164
            :|.:.:|..|
Mouse   134 RHEKEIDACI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_610936.2 TB2_DP1_HVA22 75..152 CDD:460820 29/112 (26%)
Reep4XP_006519661.1 TB2_DP1_HVA22 19..130 CDD:460820 29/111 (26%)
PRK11675 <247..>279 CDD:183272
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.