DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep4

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006519661.1 Gene:Reep4 / 72549 MGIID:1919799 Length:293 Species:Mus musculus


Alignment Length:140 Identity:37/140 - (26%)
Similarity:63/140 - (45%) Gaps:41/140 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLCNII----GVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSS------------- 112
            ::|.::    |:|||||.|..|::|...::..:|::||:.|.||...|.|:.             
Mouse     5 MICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWSGPRIGRP 69

  Fly   113 -----------------------LLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFL 154
                                   |||...|||:..|.||::|.:.|..: |::::|.|.|.|...
Mouse    70 WGWEGPHHHHHHHLASGSHKPLPLLTHRFPFYYEFKMAFVLWLLSPYTK-GASLLYRKFVHPSLS 133

  Fly   155 KHHESVDRII 164
            :|.:.:|..|
Mouse   134 RHEKEIDACI 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 33/125 (26%)
Reep4XP_006519661.1 TB2_DP1_HVA22 19..130 CDD:367349 29/111 (26%)
PRK11675 <247..>279 CDD:183272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.