DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep6

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006514140.1 Gene:Reep6 / 70335 MGIID:1917585 Length:527 Species:Mus musculus


Alignment Length:153 Identity:70/153 - (45%)
Similarity:106/153 - (69%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDT 92
            |:....:|.:|||::..:..||:.|..:||:||:||.||||:||.:||||.|:.||||.:|:|||
Mouse    19 TEALGALEARTGVEKRYLAAGALALLGLYLLFGYGASLLCNVIGFVYPAYASVKAIESPSKEDDT 83

  Fly    93 KWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHH 157
            .||.|||.:.:|.::||||.||....|||:..|||||::||.|...||:.::|::::||.|||||
Mouse    84 VWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFLLFCMTPGPWNGALLLYHRVIRPLFLKHH 148

  Fly   158 ESVD----RIIDDGMKKAAGVLK 176
            .::|    ::....:..|||:.:
Mouse   149 MALDSAASQLSGRALDLAAGITR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 46/87 (53%)
Reep6XP_006514140.1 TB2_DP1_HVA22 66..143 CDD:367349 39/76 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6307
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 177 1.000 Inparanoid score I4021
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm8791
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2369
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.