DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep2

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038953052.1 Gene:Reep2 / 682105 RGDID:1586980 Length:291 Species:Rattus norvegicus


Alignment Length:114 Identity:39/114 - (34%)
Similarity:61/114 - (53%) Gaps:4/114 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 WGAQLLC---NIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYW 122
            |.:...|   .|.|.|||||.|..|:::...::..||::||:.|..||..|..:.::.|..|||:
  Rat    39 WPSNHACLPRLIFGTLYPAYSSYKAVKTKNVKEYVKWMMYWIVFAFFTTAETLTDIILSWFPFYF 103

  Fly   123 LLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKA 171
            .||.||:||.:.|..: ||:::|.|.|.|......:.:|..|.....|:
  Rat   104 ELKIAFVIWLLSPYTK-GSSVLYRKFVHPTLSNKEKEIDEYITQARDKS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 34/90 (38%)
Reep2XP_038953052.1 TB2_DP1_HVA22 56..131 CDD:397309 29/75 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.