DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and reep3a

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001032664.1 Gene:reep3a / 641577 ZFINID:ZDB-GENE-051127-47 Length:249 Species:Danio rerio


Alignment Length:102 Identity:32/102 - (31%)
Similarity:59/102 - (57%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 AQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCA 127
            ::::..:.|.|||||.|..|::|...::..:|::||:.|.::||:|..:.|..:..|.|:.||.|
Zfish     7 SRVIVLVFGTLYPAYYSFKAVKSKNVKEYVRWMMYWIVFALYTVVETITDLSLAWFPVYYELKMA 71

  Fly   128 FLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRII 164
            |:.|.:.|..: |:::||.|.:.|........:|..|
Zfish    72 FVFWLLSPYTR-GASVIYRKFLHPMLASKEREIDEYI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 29/87 (33%)
reep3aNP_001032664.1 TB2_DP1_HVA22 7..94 CDD:281172 29/87 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.