DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and reep4

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001016224.1 Gene:reep4 / 548978 XenbaseID:XB-GENE-982259 Length:261 Species:Xenopus tropicalis


Alignment Length:111 Identity:32/111 - (28%)
Similarity:62/111 - (55%) Gaps:12/111 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVI 118
            |:.|:|           |:|||||.|..|:::...::..:|::||:.|.:|..:|.|:.:..:..
 Frog     9 AVVLVF-----------GLLYPAYASYKAVKTKNVREYVRWMMYWIVFALFMTVETFTDIFIAWF 62

  Fly   119 PFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRII 164
            |||:.:|.||::|.:.|..: |::::|.|.:.|......:.:|..|
 Frog    63 PFYYEIKMAFVVWLLSPYTR-GASLLYRKCIHPTLSLKEKEIDSYI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 26/87 (30%)
reep4NP_001016224.1 TB2_DP1_HVA22 19..94 CDD:367349 23/75 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 177..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.