DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and reep5

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001011272.1 Gene:reep5 / 496723 XenbaseID:XB-GENE-944534 Length:189 Species:Xenopus tropicalis


Alignment Length:160 Identity:83/160 - (51%)
Similarity:114/160 - (71%) Gaps:1/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAY 77
            ||...|.|.. ....|.|.:.:|.||||:|..|.:..:|:.||||:.|:||.||||:||..||||
 Frog     6 KDSFEKFLHQ-KNVCTDVLEKIEAKTGVNRRYIALAIIGIVAIYLVIGYGASLLCNLIGFAYPAY 69

  Fly    78 ISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGST 142
            :||.||||:||.|||:||.|||.:|||::||||:.:..|..|||:::||.||:|||.|:..||:|
 Frog    70 VSIKAIESATKDDDTQWLTYWVVYGIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGAT 134

  Fly   143 IIYNKLVRPYFLKHHESVDRIIDDGMKKAA 172
            :||.::|||:||||...:||::.|...||:
 Frog   135 LIYKRIVRPFFLKHEGEMDRLVKDIKDKAS 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 52/87 (60%)
reep5NP_001011272.1 TB2_DP1_HVA22 67..144 CDD:367349 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I5771
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 186 1.000 Inparanoid score I3796
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm9456
Panther 1 1.100 - - LDO PTHR12300
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.