DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and reep6

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_009304084.1 Gene:reep6 / 447918 ZFINID:ZDB-GENE-040912-98 Length:213 Species:Danio rerio


Alignment Length:168 Identity:75/168 - (44%)
Similarity:107/168 - (63%) Gaps:12/168 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVKQFLNGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCN 68
            :|:.|||      .|::      .|...:.:|||||:.:..:..||.|:...:|:.|:||.|:||
Zfish    11 RVEAFLN------EKNI------VTDCLNKIEEKTGIKKRYLAYGAAGVTGAFLLLGYGASLICN 63

  Fly    69 IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCM 133
            :||.:||||.||.||||..|:|||:||.|||.:|.|:|.||||.:.....|||::.||.||:|||
Zfish    64 LIGFVYPAYFSIKAIESPGKEDDTQWLTYWVIYGFFSVGEFFSDIFLHWFPFYYVCKCLFLLWCM 128

  Fly   134 LPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKA 171
            .|...|||.::|..:|||:||||..:||.::.:...||
Zfish   129 APVSWNGSQVLYRHVVRPFFLKHEAAVDGMVSNISVKA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 48/87 (55%)
reep6XP_009304084.1 TB2_DP1_HVA22 58..146 CDD:281172 48/87 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5859
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I4006
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm6434
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2369
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.