powered by:
Protein Alignment ReepB and AT1G04625
DIOPT Version :9
Sequence 1: | NP_001188928.1 |
Gene: | ReepB / 36569 |
FlyBaseID: | FBgn0033906 |
Length: | 178 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001154303.1 |
Gene: | AT1G04625 / 3766658 |
AraportID: | AT1G04625 |
Length: | 257 |
Species: | Arabidopsis thaliana |
Alignment Length: | 43 |
Identity: | 10/43 - (23%) |
Similarity: | 17/43 - (39%) |
Gaps: | 12/43 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 QVKQFLNGYKDD--VSKSLRDASK----------PWTKVFDTV 34
:|.:.:||...: |...:||.|. .||:.|..:
plant 162 EVSEIVNGRSSNFAVFNWIRDISAWRSKFEECKFTWTRRFSNM 204
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ReepB | NP_001188928.1 |
TB2_DP1_HVA22 |
63..151 |
CDD:281172 |
|
AT1G04625 | NP_001154303.1 |
RVT_3 |
93..211 |
CDD:372609 |
10/43 (23%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1473891at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.