DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and AT1G04625

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001154303.1 Gene:AT1G04625 / 3766658 AraportID:AT1G04625 Length:257 Species:Arabidopsis thaliana


Alignment Length:43 Identity:10/43 - (23%)
Similarity:17/43 - (39%) Gaps:12/43 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVKQFLNGYKDD--VSKSLRDASK----------PWTKVFDTV 34
            :|.:.:||...:  |...:||.|.          .||:.|..:
plant   162 EVSEIVNGRSSNFAVFNWIRDISAWRSKFEECKFTWTRRFSNM 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172
AT1G04625NP_001154303.1 RVT_3 93..211 CDD:372609 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.