DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep5

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001102358.2 Gene:Reep5 / 364838 RGDID:1306047 Length:189 Species:Rattus norvegicus


Alignment Length:144 Identity:77/144 - (53%)
Similarity:104/144 - (72%) Gaps:0/144 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDT 92
            |.:...:|.||||:|..|.:|.:||.|:||:||:||.||||:||..||||||:.||||..|.|||
  Rat    20 TDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCNLIGFGYPAYISMKAIESPNKDDDT 84

  Fly    93 KWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHH 157
            :||.|||.:|:|::.||||.|..|..|||::|||.||:|||.|:..||:.::|.:::||.||||.
  Rat    85 QWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYRRVIRPIFLKHE 149

  Fly   158 ESVDRIIDDGMKKA 171
            ..||.::.|...||
  Rat   150 SQVDSVVKDVKDKA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 49/87 (56%)
Reep5NP_001102358.2 TB2_DP1_HVA22 55..143 CDD:281172 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353610
Domainoid 1 1.000 110 1.000 Domainoid score I6168
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 178 1.000 Inparanoid score I3919
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm9038
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.