DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and reep5

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_956352.1 Gene:reep5 / 337237 ZFINID:ZDB-GENE-030131-9181 Length:189 Species:Danio rerio


Alignment Length:146 Identity:78/146 - (53%)
Similarity:104/146 - (71%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDT 92
            |.:...:|.||||:|..|....:...||||:.|:||.||||:||.:|||||||.||||..|.|||
Zfish    20 TDLLAKIEAKTGVNRSYIAYAVIAFIAIYLVIGYGASLLCNLIGFVYPAYISIKAIESPAKDDDT 84

  Fly    93 KWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHH 157
            |||.|||.:|:|:|:|||:.:..|..|||:|.|||||:|||.||..|||.::|.:::||:|||:.
Zfish    85 KWLTYWVVYGVFSVVEFFADIFLSWFPFYFLAKCAFLVWCMAPTPSNGSIMLYTRIIRPFFLKNE 149

  Fly   158 ESVDRIIDDGMKKAAG 173
            ..:|.::.|...||||
Zfish   150 AKIDNVMKDLTDKAAG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 53/87 (61%)
reep5NP_956352.1 TB2_DP1_HVA22 55..143 CDD:281172 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595748
Domainoid 1 1.000 117 1.000 Domainoid score I5859
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 179 1.000 Inparanoid score I4006
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - mtm6434
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2369
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.