DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep4

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001020450.1 Gene:Reep4 / 306014 RGDID:1306561 Length:257 Species:Rattus norvegicus


Alignment Length:104 Identity:35/104 - (33%)
Similarity:63/104 - (60%) Gaps:5/104 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LLCNII----GVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLK 125
            ::|.::    |:|||||.|..|::|...::..:|::||:.|.||...|.|:.:..|..|||:.:|
  Rat     5 MICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFISWFPFYYEIK 69

  Fly   126 CAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRII 164
            .||::|.:.|..: |::::|.|.|.|...:|.:.:|..|
  Rat    70 MAFVLWLLSPYTK-GASLLYRKFVHPSLSRHEKEIDACI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 31/89 (35%)
Reep4NP_001020450.1 TB2_DP1_HVA22 19..94 CDD:397309 27/75 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..257
PRK11675 <211..>243 CDD:183272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.