DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and Reep3

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038954514.1 Gene:Reep3 / 294375 RGDID:1560401 Length:410 Species:Rattus norvegicus


Alignment Length:103 Identity:36/103 - (34%)
Similarity:62/103 - (60%) Gaps:5/103 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCM 133
            :.|:|||||.|..|:::...::..:|::||:.|.::||||..:....:..|.|:.||.||:||.:
  Rat   169 VFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLAWFPLYYELKIAFVIWLL 233

  Fly   134 LPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKA 171
            .|..: |:::||.|.:.|..    .|.:|.|||.:.:|
  Rat   234 SPYTR-GASLIYRKFLHPLL----SSKEREIDDYIVQA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 29/81 (36%)
Reep3XP_038954514.1 TB2_DP1_HVA22 175..251 CDD:397309 26/76 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.