DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and SPBC30D10.09c

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_596276.1 Gene:SPBC30D10.09c / 2540280 PomBaseID:SPBC30D10.09c Length:217 Species:Schizosaccharomyces pombe


Alignment Length:170 Identity:34/170 - (20%)
Similarity:62/170 - (36%) Gaps:35/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQL--------------LCNIIGVLYPAYISI 80
            :.:.:...:.|....:.|..|....|.|:..:|.::              |..|||..||.|.:.
pombe     5 MLEQISLASSVVATTVLVAPVLSTIINLLTNFGQRIFIAADSSKSTSMEFLSTIIGAGYPIYKTY 69

  Fly    81 HAIE--------------------SSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLK 125
            ..:|                    .|.:::..:.:.||..:|..|..|.......|.:|||...|
pombe    70 LLLELPSKRSQLLPKAFQLRNEEHKSIEEERRRLMAYWCVYGCVTAAESILGRFLSWVPFYSTSK 134

  Fly   126 CAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIID 165
            ..|.:|.:.|..| |:..||...:.|:...|..:::..::
pombe   135 IVFWLWLLNPRTQ-GAAFIYASYISPFLSDHKAAINNFLE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 26/121 (21%)
SPBC30D10.09cNP_596276.1 TB2_DP1_HVA22 2..208 CDD:303060 34/170 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.