DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and yop1

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_588478.1 Gene:yop1 / 2539171 PomBaseID:SPCC830.08c Length:182 Species:Schizosaccharomyces pombe


Alignment Length:125 Identity:55/125 - (44%)
Similarity:82/125 - (65%) Gaps:1/125 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLI 96
            :::|:..||.::.:|:.|.|:.|::|...||..||.|::....||:.||:|||::.|.|||:||.
pombe    25 NSLEKNFGVSKLYVFLTAAGIYALFLFLNWGGFLLTNLLAFAMPAFFSINAIETTNKADDTQWLT 89

  Fly    97 YWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKH 156
            |::......|||::|.|:...:|.|||||..||||..|| :.||:||||..|:|||...|
pombe    90 YYLVTSFLNVIEYWSQLILYYVPVYWLLKAIFLIWLALP-KFNGATIIYRHLIRPYITPH 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 41/87 (47%)
yop1NP_588478.1 YOP1 3..182 CDD:227385 55/125 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2065
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68479
Inparanoid 1 1.050 122 1.000 Inparanoid score I1481
OMA 1 1.010 - - QHG57200
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 1 1.000 - - otm47152
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2369
SonicParanoid 1 1.000 - - X536
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.