DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and F56B3.6

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_499990.1 Gene:F56B3.6 / 176906 WormBaseID:WBGene00018930 Length:205 Species:Caenorhabditis elegans


Alignment Length:137 Identity:54/137 - (39%)
Similarity:79/137 - (57%) Gaps:4/137 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVFDTV---EEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQD 90
            ::||..   .|..|..|.::...|.||.|.:|:||..|:||||:||..||.|.|:.||.|....|
 Worm    63 QIFDMAMMYAESAGFKRDHLSYAAFGLIAFFLVFGSVARLLCNLIGFGYPTYASVKAIRSPGGDD 127

  Fly    91 DTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLK 155
            ||.|||||..|.:..:::|||..:.|..|||::.|..||::..||..| ||.:.|..:|.|..:.
 Worm   128 DTVWLIYWTCFAVLYLVDFFSEAILSWFPFYYIAKACFLVYLYLPQTQ-GSVMFYETIVDPLVIF 191

  Fly   156 HHESVDR 162
            ..:::|:
 Worm   192 VDKNLDK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 40/87 (46%)
F56B3.6NP_499990.1 TB2_DP1_HVA22 100..187 CDD:281172 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160982
Domainoid 1 1.000 89 1.000 Domainoid score I4957
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X536
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.