DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepB and T03F6.6

DIOPT Version :9

Sequence 1:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_499756.3 Gene:T03F6.6 / 176759 WormBaseID:WBGene00011401 Length:207 Species:Caenorhabditis elegans


Alignment Length:176 Identity:67/176 - (38%)
Similarity:102/176 - (57%) Gaps:5/176 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TQVKQFLNGYKDDVSKSLRDASKPWTKVFDTVEEKTGVDRVNIFVGAVGLCAIYLIFGWGAQLLC 67
            |..|.|.|...|..|....|....:.:....:|:.||:.|..:..|.:||..:|:|.|.||:.:|
 Worm    17 TSAKDFENLQSDFFSFLYADHGPFYKENVKKLEDATGLKREMLAYGLIGLNCVYMIIGSGAEFVC 81

  Fly    68 NIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSVIPFYWLLKCAFLIWC 132
            |:|||.||||:|:.||.:....|||.|||||..||.|::|:||::.:.|..|.||:.|.|||::.
 Worm    82 NLIGVAYPAYVSVKAIRTEGTDDDTMWLIYWTVFGAFSIIDFFAASIMSYFPIYWVAKAAFLLYL 146

  Fly   133 MLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKKAAGVLKHD 178
            .|| |.:||.:||::|:.|:.....:|:.|    .:...||.:.:|
 Worm   147 YLP-ETHGSHVIYHQLIDPFVAHMEKSMSR----KLPANAGTVPND 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 43/87 (49%)
T03F6.6NP_499756.3 TB2_DP1_HVA22 77..164 CDD:281172 43/87 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160981
Domainoid 1 1.000 89 1.000 Domainoid score I4957
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57200
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000849
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100903
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2369
SonicParanoid 1 1.000 - - X536
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.