DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Slc25a27

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006244672.1 Gene:Slc25a27 / 85262 RGDID:620787 Length:365 Species:Rattus norvegicus


Alignment Length:303 Identity:92/303 - (30%)
Similarity:149/303 - (49%) Gaps:18/303 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGTAAMGAVVFTNPIDVVKTRMQLQGE--LAARGTYV---KPYRHLPQAMLQIVLNDGLL 63
            |.|:|.|.||..|.:.|.|:|:.|||:|:|||  ||..|...   .|||.:.:..|.||..:|.|
  Rat    20 SKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALAKLGDGAMESAPYRGMMRTALGIVQEEGFL 84

  Fly    64 ALEKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYM 128
            .|.:|:.||:....|.:..|:..|.:..|:.:.::.|.....::.:..|.:.|..|.:.|:|..:
  Rat    85 KLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKSEDEHYPLWKSVIGGMMAGVIGQFLANPTDL 149

  Fly   129 IKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKA 193
            :|.|...:..:.:. |...:...:..|...|....||.|.|...:|::.|..:.:...:.|:...
  Rat   150 VKVQMQMEGKRRLE-GKPLRFRGVHHAFAKILAEGGIRGLWAGWIPNIQRAALVNMGDLTTYDTV 213

  Fly   194 KSLL-----KDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLV 253
            |..|     .:....||. |.|.|:||    :.::..:|.||:.:|:.|||.|::||||:||...
  Rat   214 KHYLVLNTALEDNIATHG-LSSLCSGL----VASILGTPADVIKSRIMNQPRDKQGRGLLYKSST 273

  Fly   254 DCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHL 296
            ||..:..:.||...:||||.|.:.|..  .|..|.||...|::
  Rat   274 DCVIQAVQGEGFLSLYKGFLPSWLRMV--KTGRFCFFLCFLYI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 34/87 (39%)
PTZ00169 5..293 CDD:240302 90/297 (30%)
Mito_carr 101..201 CDD:278578 19/104 (18%)
Mito_carr 204..296 CDD:278578 36/91 (40%)
Slc25a27XP_006244672.1 Mito_carr 20..119 CDD:278578 36/98 (37%)
Mito_carr 122..218 CDD:278578 18/96 (19%)
Mito_carr 224..311 CDD:278578 35/93 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.