DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and UCP3

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_172866.1 Gene:UCP3 / 837973 AraportID:AT1G14140 Length:305 Species:Arabidopsis thaliana


Alignment Length:299 Identity:84/299 - (28%)
Similarity:142/299 - (47%) Gaps:23/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TKSDFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTY-VKPYRHLPQAMLQIVLNDGLLAL 65
            |.:..:|...:||.|...|.|||:.||||||.|..:|.|.: :..:    ..:.:|...:|::.|
plant    12 TGTRILLASLSAMVAESVTFPIDLTKTRMQLHGSGSASGAHRIGAF----GVVSEIARKEGVIGL 72

  Fly    66 EKGLAPALCYQFVLNSVRLSVYSN--ALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYM 128
            .|||:||:........:|:..|.|  .|.:....|...|:........|...|......|||..:
plant    73 YKGLSPAIIRHLFYTPIRIIGYENLKGLIVRSETNNSESLPLATKALVGGFSGVIAQVVASPADL 137

  Fly   129 IKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKA 193
            :|.:..|.. :.::.|.:.:::..::|...|.::.|:.|.|:..||::.|..:.:..::..:..|
plant   138 VKVRMQADG-RLVSQGLKPRYSGPIEAFTKILQSEGVKGLWKGVLPNIQRAFLVNMGELACYDHA 201

  Fly   194 KSLLKDK-----GWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLV 253
            |..:.||     ....| .|.|..:||:|.:|    :.|.||:.|||.||     |...:|:...
plant   202 KHFVIDKKIAEDNIFAH-TLASIMSGLASTSL----SCPADVVKTRMMNQ-----GENAVYRNSY 256

  Fly   254 DCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEK 292
            ||..|..:.|||..::|||:|.:.|..|...:.:|.:||
plant   257 DCLVKTVKFEGIRALWKGFFPTWARLGPWQFVFWVSYEK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 26/83 (31%)
PTZ00169 5..293 CDD:240302 83/296 (28%)
Mito_carr 101..201 CDD:278578 21/104 (20%)
Mito_carr 204..296 CDD:278578 32/89 (36%)
UCP3NP_172866.1 Mito_carr 9..104 CDD:395101 30/95 (32%)
Mito_carr 110..209 CDD:395101 20/99 (20%)
Mito_carr 212..299 CDD:395101 32/94 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.