DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and slc25a27

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001011241.1 Gene:slc25a27 / 496683 XenbaseID:XB-GENE-1005902 Length:319 Species:Xenopus tropicalis


Alignment Length:305 Identity:97/305 - (31%)
Similarity:154/305 - (50%) Gaps:21/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SDFVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAAR-----GTYVKPYRHLPQAMLQIVLNDGLL 63
            |.|:|...||..|.:.|.|:|:.|||:|:|||.|.:     |:.| |||.:.:....||..:|||
 Frog    18 SKFILSACAASVAELVTFPLDLTKTRLQIQGEAALKRHGEVGSAV-PYRGMVRTATGIVQEEGLL 81

  Fly    64 ALEKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADG-SISFYRGMFFGALGGCTGTYFASPFY 127
            .|.:|..||:....|.:.||:..|.:..: ..|...|| :...::.:..|...|..|.:||||..
 Frog    82 KLWQGATPAVYRHIVYSGVRMVAYEHIRD-SVLGKGDGDTFPLWKSVVGGMTAGAIGQFFASPTD 145

  Fly   128 MIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPK 192
            ::|.|...:..:.:. |...:...:..|.:.|....||.|.|...:|::.|..:.:...:.|:..
 Frog   146 LVKVQMQMEGKRRLE-GKPPRVRGVYHAFVTIVSKGGIRGLWAGWVPNVQRAALVNMGDLTTYDM 209

  Fly   193 AKSLL------KDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKG 251
            .|..|      ||.. :.| .:.|.|:|:.:.||    .:|.||:.||:.|||.|:.||||:||.
 Frog   210 VKHFLLRNTPIKDNS-LCH-TISSICSGVVAATL----GTPADVIKTRIMNQPRDKHGRGLLYKS 268

  Fly   252 LVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHL 296
            ..||..:..|.||...:||||.|.:.|.||.:.:.::.:|::..|
 Frog   269 STDCLIQAIRGEGFMSLYKGFMPTWMRMAPWSLVFWLTYEQIRRL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 34/87 (39%)
PTZ00169 5..293 CDD:240302 95/299 (32%)
Mito_carr 101..201 CDD:278578 24/106 (23%)
Mito_carr 204..296 CDD:278578 35/91 (38%)
slc25a27NP_001011241.1 Mito_carr 18..114 CDD:365909 35/97 (36%)
Mito_carr 122..216 CDD:365909 21/94 (22%)
Mito_carr 223..313 CDD:365909 35/95 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1013743at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.