DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG1907

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:309 Identity:93/309 - (30%)
Similarity:155/309 - (50%) Gaps:22/309 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVLGGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLA 70
            |:.||.:.|||.:...|:|:||||||:.|    .|:..|.||.....:..||..:|.|||.:|:.
  Fly    21 FLFGGLSGMGATMVVQPLDLVKTRMQISG----AGSGKKEYRSSLHCIQTIVSKEGPLALYQGIG 81

  Fly    71 PALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHA 135
            .||..|....:.||.:|:...:| :.:....|......|..|.:.|..|.:..:|..:...:..:
  Fly    82 AALLRQATYTTGRLGMYTYLNDL-FREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRMTS 145

  Fly   136 QAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKS----- 195
            ..  .:.|..:..:|::.:||..|.|..|::..||.:||::.|.:|.:..|:.::.:.|:     
  Fly   146 DG--RLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHG 208

  Fly   196 -LLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYN-QPVDEKGRGLMYKGLVDCFTK 258
             |..::|     :.|.|||.:.||.|..:.:.|.|:..||:.| :.||.|..   |:|..|...:
  Fly   209 PLQMEEG-----IKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPE---YRGTADVLLR 265

  Fly   259 IWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRYVFSQRRN 307
            :.|.||:..::|||.|.|.|..|||.|||:..|:|....::||....::
  Fly   266 VARQEGVFALWKGFTPYYCRLGPHTVLTFIILEQLNQGYNKYVLGSNKS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 31/80 (39%)
PTZ00169 5..293 CDD:240302 90/293 (31%)
Mito_carr 101..201 CDD:278578 22/105 (21%)
Mito_carr 204..296 CDD:278578 35/92 (38%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 33/92 (36%)
Mito_carr 118..207 CDD:278578 20/90 (22%)
Mito_carr 219..307 CDD:278578 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441340
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.