DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and mfrn

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:304 Identity:72/304 - (23%)
Similarity:121/304 - (39%) Gaps:58/304 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LGGTAAMGAV------VFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLL--- 63
            :|.....||:      |...|:|.||||||...........|...|       .::..:|||   
  Fly    14 VGVNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSPPTKNMNIVSTLR-------TMITREGLLRPI 71

  Fly    64 ----ALEKGLAPALCYQFVLNSVRLSVYSNALEL----GYLQNADGSISFYRGMFFGALGGCTGT 120
                |:..|..||       :|:..:.|....||    ..::|.:..||       ||:......
  Fly    72 RGASAVVLGAGPA-------HSLYFAAYEMTKELTAKFTSVRNLNYVIS-------GAVATLIHD 122

  Fly   121 YFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSV 185
            ..:||..:||     |.:|.    :...:||::..:..||:..|...|:||....|...|...::
  Fly   123 AISSPTDVIK-----QRMQM----YNSPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTI 178

  Fly   186 QIGTFPKAKSLLKDKGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYK 250
            ...|:...::.:..:.....||.::  ||.::|...|...:|.||:.|.:..|   |.|   :.:
  Fly   179 HFTTYEFFQNKMNLERKYNPPVHMA--AGAAAGACAAAVTTPLDVIKTLLNTQ---ETG---LTR 235

  Fly   251 GLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTL---TFVFFE 291
            |:::...||:...|..|.::|.......|.|.|.:   |:.||:
  Fly   236 GMIEASRKIYHMAGPLGFFRGTTARVLYSMPATAICWSTYEFFK 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 22/91 (24%)
PTZ00169 5..293 CDD:240302 72/304 (24%)
Mito_carr 101..201 CDD:278578 21/99 (21%)
Mito_carr 204..296 CDD:278578 25/91 (27%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 23/97 (24%)
PTZ00168 17..280 CDD:185494 71/301 (24%)
Mito_carr 107..190 CDD:278578 22/98 (22%)
Mito_carr <215..282 CDD:278578 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441213
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.