DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG4743

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:301 Identity:72/301 - (23%)
Similarity:104/301 - (34%) Gaps:98/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLGGTAAMGAVVFTNPIDVVKTRMQLQGEL------AARGTYVKPYRHLPQAMLQIVLNDGLLAL 65
            |.||.|.|...:...|||.||||  ||.||      ..||.|                       
  Fly    32 VAGGVAGMVVDIALFPIDTVKTR--LQSELGFWRAGGFRGIY----------------------- 71

  Fly    66 EKGLAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCT---GTYFA---- 123
             ||||||                          |.||.. ...:||     ||   |..|.    
  Fly    72 -KGLAPA--------------------------AAGSAP-TAALFF-----CTYECGKQFLSSVT 103

  Fly   124 ----SPFYMIKAQQHAQAVQ-----SIAVGFQHKHT------SMMDALLHIYRTNGIS-GFWRAA 172
                ||:..:.|...|:.:.     .:.:..|...|      |.:..||..|||.|:. |.:|..
  Fly   104 QTKDSPYVHMAAASAAEVLACLIRVPVEIAKQRSQTLQGNKQSGLQILLRAYRTEGLKRGLYRGF 168

  Fly   173 LPSLNRTLVASSVQIGTFPKAKSLLKD----KGWITHPVLLSFCAGLSSGTLVAVANSPFDVLTT 233
            ..::.|.:..|.:|   ||..:.....    .|:.:.|..::.| |..:|.:.|...:|.||:.|
  Fly   169 GSTIMREIPFSLIQ---FPLWEYFKLQWTPLTGFDSTPFSVALC-GAVAGGISAGLTTPLDVVKT 229

  Fly   234 RMYNQPVDEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWP 274
            |:.....:...|....:.::.   .|:...|..|::.||.|
  Fly   230 RIMLAERESLNRRRSARRILH---GIYLERGFSGLFAGFVP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 25/85 (29%)
PTZ00169 5..293 CDD:240302 72/301 (24%)
Mito_carr 101..201 CDD:278578 28/126 (22%)
Mito_carr 204..296 CDD:278578 17/71 (24%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 33/124 (27%)
PTZ00168 25..281 CDD:185494 72/301 (24%)
Mito_carr 199..291 CDD:278578 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.