DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG5805

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:120/319 - (37%) Gaps:84/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPALCYQFVLNSVR--- 83
            |:.|:||::|:|.:...       |:.:....::|..::|:..|.:|        |.::||:   
  Fly    59 PLTVIKTQLQVQHKSDV-------YKGMVDCAMKIYRSEGVPGLYRG--------FWISSVQIVS 108

  Fly    84 ----LSVYS------NALELGYLQNADGSISFYRGMFFGALGGC---TGTYFASPFYMIKAQQHA 135
                :|.|.      |.|..|:...|            .|.|||   .|.....||.:|  .|||
  Fly   109 GVFYISTYEGVRHVLNDLGAGHRMKA------------LAGGGCASLVGQTIIVPFDVI--SQHA 159

  Fly   136 QAVQSIA----------------VGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASS 184
            ..:...|                .|....|.| ||....|.|.:|..||:|....|| ...|.:|
  Fly   160 MVLGMSAHAGSKGDINPLGIKSWPGRSRLHIS-MDIGREIMRRDGFRGFYRGYTASL-MAYVPNS 222

  Fly   185 VQIGTFPKAKSLLKDK------GWITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEK 243
            .....|   ..|.:|:      .|::| :.:...||...|....:..:|.|::..|:....:|  
  Fly   223 AMWWAF---YHLYQDELFRICPVWVSH-LFIQCVAGSLGGFTTTILTNPLDIVRARLQVHRLD-- 281

  Fly   244 GRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFE--KLLHLRDRY 300
                   .:...|.::|:.|.::..:||......:||..:....:.:|  |.:.:.::|
  Fly   282 -------SMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQY 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 15/71 (21%)
PTZ00169 5..293 CDD:240302 67/310 (22%)
Mito_carr 101..201 CDD:278578 30/124 (24%)
Mito_carr 204..296 CDD:278578 17/93 (18%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 16/80 (20%)
Mito_carr 132..238 CDD:395101 31/124 (25%)
Mito_carr 245..327 CDD:395101 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.