DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and GC2

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_731657.2 Gene:GC2 / 41449 FlyBaseID:FBgn0037970 Length:319 Species:Drosophila melanogaster


Alignment Length:284 Identity:74/284 - (26%)
Similarity:118/284 - (41%) Gaps:48/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQ-----GELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKG 68
            ||.|.:..|....|:|:||||:|.|     ||        :.|..:.....:.:.::|...:.:|
  Fly    27 GGVAGIIGVACVYPLDMVKTRLQNQTIGPNGE--------RMYTSIADCFRKTIASEGYFGMYRG 83

  Fly    69 LAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ- 132
            .|..:.......:::|:  :|.....:|.:.||.|...|....|.|.|.......:|..::|.| 
  Fly    84 SAVNIVLITPEKAIKLT--ANDFFRYHLASDDGVIPLSRATLAGGLAGLFQIVVTTPMELLKIQM 146

  Fly   133 QHAQAVQSI--AVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKS 195
            |.|..|.:.  |.|.:.|..:.:.....:.|..||.|.::....:..|.:..|.|.   || ..:
  Fly   147 QDAGRVAAADRAAGREVKTITALGLTKTLLRERGIFGLYKGVGATGVRDITFSMVY---FP-LMA 207

  Fly   196 LLKDKG-------------WITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGL 247
            .:.|:|             |       |..|||.||...|...:||||:.||:  |...||    
  Fly   208 WINDQGPRKSDGSGEAVFYW-------SLIAGLLSGMTSAFMVTPFDVVKTRL--QADGEK---- 259

  Fly   248 MYKGLVDCFTKIWRTEGIHGMYKG 271
            .:||::||..:..:.|||...:||
  Fly   260 KFKGIMDCVNRTLKEEGISAFFKG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 19/82 (23%)
PTZ00169 5..293 CDD:240302 74/284 (26%)
Mito_carr 101..201 CDD:278578 25/102 (25%)
Mito_carr 204..296 CDD:278578 25/68 (37%)
GC2NP_731657.2 PTZ00169 14..289 CDD:240302 74/284 (26%)
Mito_carr 16..106 CDD:278578 20/88 (23%)
Mito_carr 123..203 CDD:278578 19/82 (23%)
Mito_carr 228..302 CDD:278578 25/62 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.