DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and GC1

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:278 Identity:69/278 - (24%)
Similarity:114/278 - (41%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73
            ||.|.:..|....|:|:||||:|.| ::...|.  :.|..:.....:....:|...:.:|....:
  Fly    28 GGIAGIIGVTCVFPLDLVKTRLQNQ-QIGPNGE--RMYNSMFDCFRKTYKAEGYFGMYRGSGVNI 89

  Fly    74 CYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ-QHAQA 137
            .......:::|:  :|......|...||.:.....|..|.|.|.......:|..::|.| |.|..
  Fly    90 LLITPEKAIKLT--ANDYFRHKLTTKDGKLPLTSQMVAGGLAGAFQIIVTTPMELLKIQMQDAGR 152

  Fly   138 VQSIA--VGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDK 200
            |.:.|  .|...:..|.......:.:..||.|.::....:..|.:..|.:....|    :.|.|.
  Fly   153 VAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVTFSIIYFPLF----ATLNDL 213

  Fly   201 G------------WITHPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLV 253
            |            |      .||.|||::|:..|:|.:||||:.||:  |.:.:......:||:.
  Fly   214 GPRRNDGSGEAVFW------CSFLAGLAAGSTAALAVNPFDVVKTRL--QAIKKADGEKEFKGIS 270

  Fly   254 DCFTKIWRTEGIHGMYKG 271
            ||.||..:.||....:||
  Fly   271 DCITKTLKHEGPTAFFKG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 17/77 (22%)
PTZ00169 5..293 CDD:240302 69/278 (25%)
Mito_carr 101..201 CDD:278578 22/102 (22%)
Mito_carr 204..296 CDD:278578 25/68 (37%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 16/81 (20%)
Mito_carr 115..213 CDD:278578 21/101 (21%)
Mito_carr 226..307 CDD:278578 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.