DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and CG2616

DIOPT Version :9

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:329 Identity:85/329 - (25%)
Similarity:136/329 - (41%) Gaps:60/329 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TAAMGAVVFTNPIDVVKTRMQLQGELAAR------------------GTYVKPYRHLPQ------ 51
            |.||....|..|:||:|||||.|...|.:                  |:.:...|..||      
  Fly    99 TGAMITACFMTPLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQFSSSWD 163

  Fly    52 AMLQIVLNDGLLALEKGLAPAL------------CY-QFVLNSVRL--SVYSNALELGYLQNAD- 100
            |:::|..::||.||..||.|.|            .| ||....:::  |.|:.:.|..:|:..| 
  Fly   164 ALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHLEIRDT 228

  Fly   101 -GSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLHIYRTNG 164
             .|:.....|..|...........||..:::.:..||         :..:..|:..:..:....|
  Fly   229 KKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQAQ---------RQTYAQMLQFVRSVVALQG 284

  Fly   165 ISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL-LSFCAGLSSGTLVAVANSPF 228
            :.|.||...|::.|.:..|.:.   :|..:||.::.|..:.|.. |||.||:.:||:.|:..:||
  Fly   285 VWGLWRGLRPTILRDVPFSGIY---WPIYESLKQNLGHGSQPSFSLSFLAGVMAGTVAAIVTTPF 346

  Fly   229 DVLTTR---MYNQPV---DEKGRGLMYKGLVDCFTKIWRTEGIHGMYKGFWPIYFRSAPHTTLTF 287
            ||:.|.   .:.:.|   |...|....|......|.|:||.|:.|::.|..|...:.||...:..
  Fly   347 DVVKTHEQIEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVRGLFAGCGPRLLKVAPACAIMI 411

  Fly   288 VFFE 291
            ..||
  Fly   412 STFE 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 32/114 (28%)
PTZ00169 5..293 CDD:240302 85/329 (26%)
Mito_carr 101..201 CDD:278578 18/99 (18%)
Mito_carr 204..296 CDD:278578 30/95 (32%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 31/107 (29%)
Mito_carr 230..321 CDD:278578 19/102 (19%)
Mito_carr 321..425 CDD:278578 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.