DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18324 and Dic4

DIOPT Version :10

Sequence 1:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_649054.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:294 Identity:68/294 - (23%)
Similarity:119/294 - (40%) Gaps:36/294 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GGTAAMGAVVFTNPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKGLAPAL 73
            ||.|:|.......|||:|||.||:|          :..|.:...:.:|....|.|....|.:.|:
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQ----------RQKRSILGTVKRIHSLKGYLGFYDGFSAAI 80

  Fly    74 CYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQQHAQAV 138
            ..|....::...||....::.|:...    |:...:..|.:.|..|:.|..|..:|..:......
  Fly    81 LRQMTSTNIHFIVYDTGKKMEYVDRD----SYLGKIILGCVAGACGSAFGIPTDLINVRMQTDMK 141

  Fly   139 QSIAVGFQHKHTSMMDALLHIYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWI 203
            :.......:||  :.|.|:.|.:..|....::....::.::.:::..||..:...|:.::....:
  Fly   142 EPPYKRRNYKH--VFDGLIRIPKEEGWKALYKGGSVAVFKSSLSTCSQIAFYDIIKTEVRKNISV 204

  Fly   204 THPVLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTKIWRTE----- 263
            ...:.|.|...|.:..:.:....|.||:.|.|.|....|             |..:::..     
  Fly   205 NDGLPLHFLTSLGTSIISSAITHPLDVVRTIMMNSRPGE-------------FRTVFQASVHMMR 256

  Fly   264 -GIHGMYKGFWPIYFRSAPHTTLTFVFFEKL-LH 295
             |:.|.|:||.|...|.||.|||.||.:|:| ||
  Fly   257 FGVMGPYRGFVPTIVRKAPATTLLFVLYEQLRLH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18324NP_725361.1 Mito_carr 4..87 CDD:395101 20/77 (26%)
Mito_carr 101..201 CDD:395101 16/99 (16%)
Mito_carr 204..296 CDD:395101 29/99 (29%)
Dic4NP_649054.1 Mito_carr 26..100 CDD:395101 22/83 (27%)
Mito_carr 104..201 CDD:395101 16/102 (16%)
Mito_carr 211..292 CDD:395101 28/93 (30%)

Return to query results.
Submit another query.